Recombinant Mouse Gdf15 protein, His-SUMO-tagged
| Cat.No. : | Gdf15-7573M |
| Product Overview : | Recombinant Mouse Gdf15 protein(Q9Z0J7)(189-303aa), fused with N-terminal His-SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 189-303aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA |
| Gene Name | Gdf15 growth differentiation factor 15 [ Mus musculus ] |
| Official Symbol | Gdf15 |
| Synonyms | GDF15; growth differentiation factor 15; growth/differentiation factor 15; GDF-15; macrophage inhibiting cytokine-1; SBF; MIC-1; NAG-1; |
| Gene ID | 23886 |
| mRNA Refseq | NM_011819 |
| Protein Refseq | NP_035949 |
| ◆ Recombinant Proteins | ||
| GDF15-17H | Recombinant Human GDF15 Protein | +Inquiry |
| GDF15-047H | Recombinant Human GDF15 Protein | +Inquiry |
| GDF15-1855H | Active Recombinant Human GDF15 protein, Avi & Fc-tagged, Biotinylated | +Inquiry |
| GDF15-1277R | Recombinant Rhesus monkey GDF15 protein, His-tagged | +Inquiry |
| GDF15-101H | Recombinant Human GDF15 Protein, Ala197-Ile308, N-hFc tagged, Biotinylated | +Inquiry |
| ◆ Native Proteins | ||
| GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDF15-2705HCL | Recombinant Human GDF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gdf15 Products
Required fields are marked with *
My Review for All Gdf15 Products
Required fields are marked with *



