Recombinant Mouse Gdf15 protein, His-SUMO-tagged

• Cat.No.: Gdf15-7573M
• Product Overview: Recombinant Mouse Gdf15 protein(Q9Z0J7)(189-303aa), fused with N-terminal His-SUMO tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 189-303aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Gene Information

• Gene Name: Gdf15 growth differentiation factor 15 [ Mus musculus ]
• Official Symbol: Gdf15
• Synonyms: GDF15; growth differentiation factor 15; growth/differentiation factor 15; GDF-15; macrophage inhibiting cytokine-1; SBF; MIC-1; NAG-1
• Gene ID: 23886
• mRNA Refseq: NM_011819
• Protein Refseq: NP_035949