Species : |
Mouse |
Source : |
E.coli |
Description : |
Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Potent mesangial cell chemoattractant. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. |
Molecular Mass : |
12 kDa |
AA Sequence : |
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
Endotoxin : |
Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : |
>95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : |
Store at -80 centigrade. |
Storage Buffer : |
Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |