Recombinant Mouse Gm1987 Protein
Cat.No. : | Gm1987-027M |
Product Overview : | Purified recombinant protein of Mouse predicted gene 1987 (Gm1987) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Potent mesangial cell chemoattractant. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. |
Molecular Mass : | 12 kDa |
AA Sequence : | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Gm1987 predicted gene 1987 [ Mus musculus (house mouse) ] |
Official Symbol | Gm1987 |
Synonyms | Gm1987; predicted gene 1987; 100038965 |
Gene ID | 100504362 |
mRNA Refseq | NM_001193667 |
Protein Refseq | NP_001180596 |
UniProt ID | P84444 |
◆ Recombinant Proteins | ||
GM1987-6702M | Recombinant Mouse GM1987 Protein | +Inquiry |
Gm1987-027M | Recombinant Mouse Gm1987 Protein | +Inquiry |
GM1987-3683M | Recombinant Mouse GM1987 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gm1987 Products
Required fields are marked with *
My Review for All Gm1987 Products
Required fields are marked with *
0
Inquiry Basket