Recombinant Mouse Gmfb protein
Cat.No. : | Gmfb-1885M |
Product Overview : | Recombinant Mouse Gmfb protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 141 |
Description : | The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : | Approximately 16.6 kDa, a single non-glycosylated polypeptide chain containing 141 amino acid residues. |
AA Sequence : | SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
Endotoxin : | Less than 1 EU/μg of rMuGMF-β as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Gmfb |
Official Symbol | Gmfb |
Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF-beta; C79176; AI851627; D14Ertd630e; 3110001H22Rik; 3110001O16Rik; |
Gene ID | 63985 |
mRNA Refseq | NM_022023 |
Protein Refseq | NP_071306 |
UniProt ID | Q9CQI3 |
◆ Recombinant Proteins | ||
GMFB-2877C | Recombinant Chicken GMFB | +Inquiry |
Gmfb-593R | Recombinant Rat Gmfb protein | +Inquiry |
GMFB-3247H | Recombinant Human GMFB Protein (Met1-His142), C-His tagged | +Inquiry |
Gmfb-650M | Recombinant Mouse Gmfb | +Inquiry |
GMFB-04H | Recombinant Human Glia Maturation Factor beta | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gmfb Products
Required fields are marked with *
My Review for All Gmfb Products
Required fields are marked with *
0
Inquiry Basket