Recombinant Mouse Gsdmd protein, GST-tagged
| Cat.No. : | Gsdmd-8544M |
| Product Overview : | Recombinant Mouse Gsdmd protein(199-487 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | GST |
| Protein Length : | 199-487 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC |
| Gene Name | Gsdmd gasdermin D [ Mus musculus ] |
| Official Symbol | Gsdmd |
| Synonyms | GSDMD; gasdermin D; gasdermin-D; gasdermin domain containing 1; gasdermin domain-containing protein 1; DF5L; M2-4; Dfna5l; Gsdmdc1; AW558049; 1810036L03Rik; |
| Gene ID | 69146 |
| mRNA Refseq | NM_026960 |
| Protein Refseq | NP_081236 |
| ◆ Recombinant Proteins | ||
| GSDMD-7312M | Recombinant Mouse GSDMD Protein | +Inquiry |
| Gsdmd-8545M | Recombinant Mouse Gsdmd protein, His-tagged | +Inquiry |
| GSDMD-32H | Recombinant Human GSDMD protein, GST-tagged | +Inquiry |
| GSDMD-722HF | Recombinant Full Length Human GSDMD Protein, GST-tagged | +Inquiry |
| GSDMD-2823H | Recombinant Human GSDMD Protein (Pro278-His484), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSDMD-5725HCL | Recombinant Human GSDMD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gsdmd Products
Required fields are marked with *
My Review for All Gsdmd Products
Required fields are marked with *
