Recombinant Mouse Hbb-b2 Protein (2-147 aa), His-tagged

• Cat.No.: Hbb-b2-1618M
• Product Overview: Recombinant Mouse Hbb-b2 Protein (2-147 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 2-147 aa
• Description: Involved in oxygen transport from the lung to the various peripheral tissues.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.7 kDa
• AA Sequence: VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Hbb-b2 hemoglobin, beta adult minor chain [ Mus musculus (house mouse) ]
• Official Symbol: Hbb-b2
• Synonyms: Hbb2; Hbbt2; beta2; AI036344
• Gene ID: 15130
• mRNA Refseq: NM_016956
• Protein Refseq: NP_058652
• UniProt ID: P02089