Recombinant Mouse Hgf Protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Hgf Protein

Recombinant Mouse Hgf Protein

Hgf Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Hgf-4731M
Product Overview : Mouse Hgf (Q08048) full length recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) Insect cells.
Description : This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the hepatocyte growth factor alpha and beta chains, which heterodimerize to form the mature active protein. Although this protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Homozygous knockout mice for this gene exhibit embryonic lethality due to impaired development of the placenta and liver. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]
Source : Insect Cell
Species : Mouse
Form : Lyophilized
Bio-activity : Determined by the dose-dependent stimulation of the proliferation of mouse IMCD3 cells using a concentration range of 10-20 ng/mL.
AA Sequence : alpha chain: QKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR
Beta chain: VVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL
Endotoxin : Endotoxin level is < 0.1 ng/μg (< 1 EU/μg).
Purity : 95%
Applications : Functional Study
SDS-PAGE
Usage : Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -2 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name : Hgf hepatocyte growth factor [ Mus musculus ]
Official Symbol : Hgf
Synonyms : HGF; hepatocyte growth factor; SF; scatter factor; hepatopoeitin-A; hepatopoietin-A; NK1; NK2; HGF/SF; SF/HGF; C230052L06Rik;
Gene ID : 15234
mRNA Refseq : NM_010427
Protein Refseq : NP_034557

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Verification Code Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2021 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy