Recombinant Mouse HMOX1 Protein (1-289 aa), His-tagged

• Cat.No.: HMOX1-1412M
• Product Overview: Recombinant Mouse HMOX1 Protein (1-289 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 1-289 aa
• Description: He oxygenase cleaves the he ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of he oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free he sensitizes cells to undergo apoptosis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.9 kDa
• AA Sequence: MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Hmox1 heme oxygenase (decycling) 1 [ Mus musculus ]
• Official Symbol: HMOX1
• Synonyms: HMOX1; P32 protein; HO1; HO-1; Hmox; Hemox; Hsp32; D8Wsu38e
• Gene ID: 15368
• mRNA Refseq: NM_010442
• Protein Refseq: NP_034572
• UniProt ID: P14901