Recombinant Mouse Hmox1 protein, His-B2M-tagged
| Cat.No. : | Hmox1-3041M |
| Product Overview : | Recombinant Mouse Hmox1 protein(P14901)(1-289aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 1-289aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 46.9 kDa |
| AA Sequence : | MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Hmox1 heme oxygenase (decycling) 1 [ Mus musculus ] |
| Official Symbol | Hmox1 |
| Synonyms | HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; P32 protein; hemoxygenase; HO1; HO-1; Hmox; Hemox; Hsp32; D8Wsu38e; |
| Gene ID | 15368 |
| mRNA Refseq | NM_010442 |
| Protein Refseq | NP_034572 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hmox1 Products
Required fields are marked with *
My Review for All Hmox1 Products
Required fields are marked with *
