Recombinant Mouse Hmox1 protein, His-B2M-tagged
Cat.No. : | Hmox1-3041M |
Product Overview : | Recombinant Mouse Hmox1 protein(P14901)(1-289aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 1-289aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Hmox1 heme oxygenase (decycling) 1 [ Mus musculus ] |
Official Symbol | Hmox1 |
Synonyms | HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; P32 protein; hemoxygenase; HO1; HO-1; Hmox; Hemox; Hsp32; D8Wsu38e; |
Gene ID | 15368 |
mRNA Refseq | NM_010442 |
Protein Refseq | NP_034572 |
◆ Recombinant Proteins | ||
HMOX1-2527R | Recombinant Rat HMOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALLC-3745H | Recombinant Human ALLC protein, His-tagged | +Inquiry |
HMOX1-2872R | Recombinant Rat HMOX1 Protein | +Inquiry |
HMOX1-023H | Recombinant Human HMOX1 Protein, His-tagged | +Inquiry |
HMOX1-1597H | Recombinant Human Heme Oxygenase (decycling) 1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMOX1-5467HCL | Recombinant Human HMOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hmox1 Products
Required fields are marked with *
My Review for All Hmox1 Products
Required fields are marked with *
0
Inquiry Basket