Recombinant Mouse Hp protein, His-tagged
Cat.No. : | Hp-4644M |
Product Overview : | Recombinant Mouse Hp protein(Q61646)(19-347aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-347aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN |
Gene Name | Hp haptoglobin [ Mus musculus ] |
Official Symbol | Hp |
Synonyms | HP; haptoglobin; HP-1; |
Gene ID | 15439 |
mRNA Refseq | NM_017370 |
Protein Refseq | NP_059066 |
◆ Recombinant Proteins | ||
HP-957R | Recombinant Rat Haptoglobin Protein (Met1-Asn347), His-tagged | +Inquiry |
HP-1891H | Recombinant Human HP Protein, MYC/DDK-tagged | +Inquiry |
Hp-7754M | Recombinant Mouse Hp protein, His-tagged | +Inquiry |
HP-2719H | Recombinant Human HP Protein (Gln160-Glu405), N-His tagged | +Inquiry |
Hp-7758R | Recombinant Rat Hp protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Hp-194R | Native Rat Haptoglobin | +Inquiry |
HP-192F | Native Feline Haptoglobin | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
HP-193S | Native Swine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HP-5408HCL | Recombinant Human HP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hp Products
Required fields are marked with *
My Review for All Hp Products
Required fields are marked with *