Recombinant Mouse Ifi204 protein, His-tagged
Cat.No. : | Ifi204-4632M |
Product Overview : | Recombinant Mouse Ifi204 protein(P0DOV2)(216-417aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 216-417aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLKTIDRQPKLVCGEHSFIKISKRGN |
Gene Name | Ifi204 interferon activated gene 204 [ Mus musculus ] |
Official Symbol | Ifi204 |
Synonyms | IFI204; interferon activated gene 204; interferon-activable protein 204; ifi-204; interferon-inducible protein p204; interferon, gamma-inducible gene 204; interferon, gamma-inducible protein 16; p204; Ifi16; |
Gene ID | 15951 |
mRNA Refseq | NM_008329 |
Protein Refseq | NP_032355 |
◆ Recombinant Proteins | ||
Ifi204-642M | Recombinant Mouse Ifi204 protein, His-tagged | +Inquiry |
Ifi204-543M | Recombinant Mouse Ifi204 protein, His&Myc-tagged | +Inquiry |
Ifi204-4632M | Recombinant Mouse Ifi204 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifi204 Products
Required fields are marked with *
My Review for All Ifi204 Products
Required fields are marked with *