Recombinant Mouse Ifi30 protein, His-tagged
Cat.No. : | Ifi30-4685M |
Product Overview : | Recombinant Mouse Ifi30 protein(Q9ESY9)(55-230 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 55-230 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 21.6 kDa |
AASequence : | PSPPVRVSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSIVCQLYQGTE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
IFI30-7185H | Recombinant Human Interferon, Gamma-Inducible Protein 30, His-tagged | +Inquiry |
IFI30-1317H | Recombinant Human IFI30 protein, His & T7-tagged | +Inquiry |
IFI30-7855H | Recombinant Human IFI30 protein, His-tagged | +Inquiry |
IFI30-1567Z | Recombinant Zebrafish IFI30 | +Inquiry |
IFI30-3785H | Recombinant Human IFI30 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI30-1503HCL | Recombinant Human IFI30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifi30 Products
Required fields are marked with *
My Review for All Ifi30 Products
Required fields are marked with *