Recombinant Mouse IFNAR2 Protein (22-242 aa), His-tagged

Cat.No. : IFNAR2-2339M
Product Overview : Recombinant Mouse IFNAR2 Protein (22-242 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 22-242 aa
Description : Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and 3 may be potent inhibitors of type I IFN receptor activity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.8 kDa
AA Sequence : SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Ifnar2 interferon (alpha and beta) receptor 2 [ Mus musculus ]
Official Symbol IFNAR2
Synonyms IFNAR2; IFN-R-2; interferon receptor 2c; IFN-alpha/beta receptor 2; Ifnar-2; AI747302;
Gene ID 15976
mRNA Refseq NM_001110498
Protein Refseq NP_001103968
UniProt ID O35664

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNAR2 Products

Required fields are marked with *

My Review for All IFNAR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon