Recombinant Mouse IFNAR2 Protein (22-242 aa), His-tagged

• Cat.No.: IFNAR2-2339M
• Product Overview: Recombinant Mouse IFNAR2 Protein (22-242 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 22-242 aa
• Description: Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and 3 may be potent inhibitors of type I IFN receptor activity.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.8 kDa
• AA Sequence: SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Ifnar2 interferon (alpha and beta) receptor 2 [ Mus musculus ]
• Official Symbol: IFNAR2
• Synonyms: IFNAR2; IFN-R-2; interferon receptor 2c; IFN-alpha/beta receptor 2; Ifnar-2; AI747302
• Gene ID: 15976
• mRNA Refseq: NM_001110498
• Protein Refseq: NP_001103968
• UniProt ID: O35664