Recombinant Mouse IFNAR2 Protein (22-242 aa), His-tagged
Cat.No. : | IFNAR2-2339M |
Product Overview : | Recombinant Mouse IFNAR2 Protein (22-242 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 22-242 aa |
Description : | Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and 3 may be potent inhibitors of type I IFN receptor activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.8 kDa |
AA Sequence : | SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Ifnar2 interferon (alpha and beta) receptor 2 [ Mus musculus ] |
Official Symbol | IFNAR2 |
Synonyms | IFNAR2; IFN-R-2; interferon receptor 2c; IFN-alpha/beta receptor 2; Ifnar-2; AI747302; |
Gene ID | 15976 |
mRNA Refseq | NM_001110498 |
Protein Refseq | NP_001103968 |
UniProt ID | O35664 |
◆ Recombinant Proteins | ||
Ifnar2-683M | Active Recombinant Mouse Ifnar2, Fc Chimera | +Inquiry |
IFNAR2-1303R | Recombinant Rat IFNAR2 protein, His-tagged | +Inquiry |
IFNAR2-1194C | Recombinant Cynomolgus IFNAR2 Protein, His-tagged | +Inquiry |
IFNAR2-0238M | Active Recombinant Mouse IFNAR2 protein, His-tagged | +Inquiry |
IFNAR2-3349H | Recombinant Human IFNAR2 protein(Met1-Lys243), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNAR2-2243HCL | Recombinant Human IFNAR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNAR2 Products
Required fields are marked with *
My Review for All IFNAR2 Products
Required fields are marked with *
0
Inquiry Basket