Recombinant Mouse IFNB1 Protein
Cat.No. : | IFNB1-496M |
Product Overview : | Recombinant Mouse IFNB1 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Protein Length : | 182 |
Description : | Enables cytokine activity and type I interferon receptor binding activity. Involved in B cell proliferation; cellular response to virus; and type I interferon signaling pathway. Acts upstream of or within several processes, including cellular response to organic cyclic compound; defense response to other organism; and negative regulation of osteoclast differentiation. Located in extracellular space. Is expressed in embryo and liver. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1). |
Form : | Lyophilized |
AA Sequence : | MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Ifnb1 interferon beta 1, fibroblast [ Mus musculus (house mouse) ] |
Official Symbol | IFNB1 |
Synonyms | IFNB1; interferon beta 1, fibroblast; interferon beta; Ifb; IFNB; IFN-beta; |
Gene ID | 15977 |
mRNA Refseq | NM_010510 |
Protein Refseq | NP_034640 |
UniProt ID | P01575 |
◆ Recombinant Proteins | ||
IFNB1-247R | Recombinant Rabbit IFNB1 Protein, His-tagged | +Inquiry |
IFNB1-4405R | Recombinant Rabbit IFNB1 Protein | +Inquiry |
Ifnb1-178M | Recombinant Mouse interferon beta 1, fibroblast Protein, Tag Free | +Inquiry |
IFNB1-8538H | Recombinant Human IFNB1 | +Inquiry |
Ifnb1-1217M | Active Recombinant Mouse Ifnb1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNB1 Products
Required fields are marked with *
My Review for All IFNB1 Products
Required fields are marked with *
0
Inquiry Basket