Recombinant Mouse IFNB1 Protein

Cat.No. : IFNB1-496M
Product Overview : Recombinant Mouse IFNB1 protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Protein Length : 182
Description : Enables cytokine activity and type I interferon receptor binding activity. Involved in B cell proliferation; cellular response to virus; and type I interferon signaling pathway. Acts upstream of or within several processes, including cellular response to organic cyclic compound; defense response to other organism; and negative regulation of osteoclast differentiation. Located in extracellular space. Is expressed in embryo and liver. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1).
Form : Lyophilized
AA Sequence : MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Ifnb1 interferon beta 1, fibroblast [ Mus musculus (house mouse) ]
Official Symbol IFNB1
Synonyms IFNB1; interferon beta 1, fibroblast; interferon beta; Ifb; IFNB; IFN-beta;
Gene ID 15977
mRNA Refseq NM_010510
Protein Refseq NP_034640
UniProt ID P01575

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNB1 Products

Required fields are marked with *

My Review for All IFNB1 Products

Required fields are marked with *

0
cart-icon