Recombinant Human IFNE protein, His-tagged
Cat.No. : | IFNE-4603H |
Product Overview : | Recombinant Human IFNE protein(Q86WN2)(22-208aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-208aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IFNE interferon, epsilon [ Homo sapiens ] |
Official Symbol | IFNE |
Synonyms | IFNE; interferon, epsilon; interferon epsilon; IFNE1; IFN-epsilon; interferon tau-1; interferon-epsilon; interferon epsilon 1; interferon epsilon-1; IFN-E; IFNT1; PRO655; MGC119018; MGC119020; |
Gene ID | 338376 |
mRNA Refseq | NM_176891 |
Protein Refseq | NP_795372 |
UniProt ID | Q86WN2 |
◆ Recombinant Proteins | ||
IFNE-54H | Recombinant Human IFNE protein, GST-tagged | +Inquiry |
IFNE-4603H | Recombinant Human IFNE protein, His-tagged | +Inquiry |
IFNE-619HF | Recombinant Full Length Human IFNE Protein, GST-tagged | +Inquiry |
IFNE-3697H | Recombinant Human IFNE Protein (Gln30-Arg208), N-His tagged | +Inquiry |
IFNE-083H | Active Recombinant Human IFNE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNE-5278HCL | Recombinant Human IFNE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNE Products
Required fields are marked with *
My Review for All IFNE Products
Required fields are marked with *