Recombinant Mouse Ifng protein, GST-tagged
Cat.No. : | Ifng-7854M |
Product Overview : | Recombinant Mouse Ifng protein(23-155 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 23-155 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
Gene Name | Ifng interferon gamma [ Mus musculus ] |
Official Symbol | Ifng |
Synonyms | IFNG; interferon gamma; IFN-gamma; gamma interferon; Ifg; IFN-g; |
Gene ID | 15978 |
mRNA Refseq | NM_008337 |
Protein Refseq | NP_032363 |
◆ Recombinant Proteins | ||
IFNG-09H | Recombinant Human Interferon Gamma | +Inquiry |
IFNG-981H | Recombinant Horse IFNG Protein, His-tagged | +Inquiry |
IFNG-33CFL | Recombinant Full length Canine interferon gamma Protein, Tag Free | +Inquiry |
IFNG-119H | Recombinant Active Human IFNG Protein, His-tagged(C-ter) | +Inquiry |
IFNG-3077M | Recombinant Marmota monax (Woodchuck) IFNG protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket