| Species : |
Mouse |
| Source : |
Insect Cells |
| Protein Length : |
98-330 |
| Description : |
Immunoglobulins are major components of what is called the humoral immune response system. They are synthesized by lymphocytes and plasma cells and found in the serum and in other body fluids and tissues, including the urine, spinal fluid, lymph nodes, and spleen. Each immunoglobulin molecule consists of four polypeptide chains: two heavy chains (H chains) and two light chains (L chains). There are five antigenically different kinds of H chains, and this difference is the basis for the classification of immunoglobulins. The five major classes of immunoglobulins (Ig) are IgA, IgD, IgE, IgG, and IgM. Each class varies in its chemical structure and in its number of antigen-binding sites and adheres to and reacts only with the specific antigen for which it was produced. |
| Form : |
Liquid |
| Molecular Mass : |
26.6 kDa |
| AA Sequence : |
ADPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Purity : |
> 90 % by SDS-PAGE |
| Stability : |
Shelf life: one year from despatch. |
| Storage : |
Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
| Storage Buffer : |
20 mM Tris-HCl buffer (pH 8.0) |