Recombinant Mouse IL10 Protein
Cat.No. : | IL10-115M |
Product Overview : | Recombinant Mouse Interleukin-10 is produced by our E.coli expression system and the target gene encoding Ser19-Ser178 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | Ser19-Ser178 |
Description : | Mouse Il10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. Many viruses encode viral members of the IL-10 family, such as Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV).Its main function is inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Although human and mouse IL-10 are 81% identical at the nucleotide and amino acid level, mouse IL-10 is species-specific and does not act on human cells. Interestingly, Human IL-10 is active on mouse cells. |
Form : | Lyophilized from a 0.2 um filtered solution of PBS, pH7.4. |
AA Sequence : | MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQ FYLVEVMPQAE KHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAY MMIKMKS |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | Il10 interleukin 10 [ Mus musculus (house mouse) ] |
Official Symbol | IL10 |
Synonyms | Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF; If2a |
Gene ID | 16153 |
mRNA Refseq | NM_010548.2 |
Protein Refseq | NP_034678.1 |
UniProt ID | P18893 |
◆ Recombinant Proteins | ||
Il10-01M | Active Recombinant Mouse Il10 Protein, His-Tagged | +Inquiry |
IL10-569P | Active Recombinant Pig IL10 protein | +Inquiry |
Il10-371I | Active Recombinant Rat Il10 Protein (161 aa) | +Inquiry |
IL10-001M | Active Recombinant Mouse IL10, MIgG2a Fc-tagged | +Inquiry |
IL10-599H | Active Recombinant Human IL10, MIgG2a Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *