Recombinant Mouse IL17F Protein

Cat.No. : IL17F-144M
Product Overview : Recombinant Mouse IL17F Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes.
Bio-activity : No biological activity data is available at this time.
AA Sequence : MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution:
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Gene Name Il17f interleukin 17F [ Mus musculus (house mouse) ]
Official Symbol IL17F
Synonyms IL17F; interleukin 17F; interleukin-17F; C87042; IL-17F;
Gene ID 257630
mRNA Refseq NM_145856
Protein Refseq NP_665855
UniProt ID Q7TN17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17F Products

Required fields are marked with *

My Review for All IL17F Products

Required fields are marked with *

0
cart-icon
0
compare icon