Recombinant Mouse IL17F Protein
Cat.No. : | IL17F-144M |
Product Overview : | Recombinant Mouse IL17F Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes. |
Bio-activity : | No biological activity data is available at this time. |
AA Sequence : | MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | Il17f interleukin 17F [ Mus musculus (house mouse) ] |
Official Symbol | IL17F |
Synonyms | IL17F; interleukin 17F; interleukin-17F; C87042; IL-17F; |
Gene ID | 257630 |
mRNA Refseq | NM_145856 |
Protein Refseq | NP_665855 |
UniProt ID | Q7TN17 |
◆ Recombinant Proteins | ||
IL17F-099I | Active Recombinant Human IL17F Protein (133 aa) | +Inquiry |
IL17F-964H | Recombinant Human IL17F protein, His-Avi-tagged | +Inquiry |
IL17F-6030C | Recombinant Chicken IL17F | +Inquiry |
IL17F-36H | Recombinant Human IL17F protein | +Inquiry |
IL17F-01H | Recombinant Human IL17F Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17F Products
Required fields are marked with *
My Review for All IL17F Products
Required fields are marked with *