Recombinant Mouse Il19 protein
Cat.No. : | Il19-72M |
Product Overview : | Recombinant Mouse Il19 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 152 |
Description : | Interleukin-19 (IL-19) belongs to the IL-10 family that includes IL-10, IL-20, IL-22, IL-24, and IL-26. As a monomer made of seven amphipathic helices, IL-19 has a helical bundle and shares the same cell surface receptor (IL-20R) with IL-20 and IL-24. It may play some important roles in inflammatory responses because it up-regulates IL-6 and TNF-alpha and induces apoptosis. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 3 % Trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. |
AA Sequence : | LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA |
Endotoxin : | Less than 0.1 EU/µg of rMuIL-19 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il19 |
Official Symbol | Il19 |
Synonyms | IL19; interleukin 19; interleukin-19; IL-19; |
Gene ID | 329244 |
mRNA Refseq | NM_001009940 |
Protein Refseq | NP_001009940 |
UniProt ID | Q8CJ70 |
◆ Recombinant Proteins | ||
Il19-367I | Active Recombinant Mouse Il19 Protein (153 aa) | +Inquiry |
Il19-1668R | Recombinant Rat Il19 Protein, His-tagged | +Inquiry |
IL19-151H | Recombinant Human IL19 Protein, His-tagged | +Inquiry |
IL19-1470H | Recombinant Human IL19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL19-482H | Active Recombinant Human IL19 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL19-5242HCL | Recombinant Human IL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il19 Products
Required fields are marked with *
My Review for All Il19 Products
Required fields are marked with *
0
Inquiry Basket