Recombinant Mouse Il3 protein
| Cat.No. : | Il3-09M |
| Product Overview : | Recombinant Mouse Il3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 134 |
| Description : | Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition, it exerts its biological activities through binding to interleukin-3 receptors included α and β subunits. The Mouse IL-3 is different from human IL-3 and contains 140 amino acids residues. Specifically, mouse and human IL-3 share low homology and have not cross species activity. |
| Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2 × 10⁷ IU/mg. |
| Molecular Mass : | Approximately 14.8 kDa globular protein containing 134 amino acid residues. |
| AA Sequence : | DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| Endotoxin : | Less than 1 EU/µg of rMuIL-3 as determined by LAL method. |
| Purity : | >98% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Il3 |
| Official Symbol | Il3 |
| Synonyms | IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu; |
| Gene ID | 16187 |
| mRNA Refseq | NM_010556 |
| Protein Refseq | NP_034686 |
| UniProt ID | P01586 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *




