Recombinant Mouse Il3 protein, His-tagged
Cat.No. : | Il3-4682M |
Product Overview : | Recombinant Mouse Il3 protein(P01586)(27-166 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-166 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 17.7 kDa |
AASequence : | ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Il3 interleukin 3 [ Mus musculus ] |
Official Symbol | Il3 |
Synonyms | IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu; |
Gene ID | 16187 |
mRNA Refseq | NM_010556 |
Protein Refseq | NP_034686 |
◆ Recombinant Proteins | ||
IL3-7433H | Recombinant Human IL3 protein, His-Avi-tagged | +Inquiry |
IL3-8862H | Active Recombinant Human IL3, His-tagged | +Inquiry |
IL3-88M | Recombinant Mouse IL3 Protein, His-tagged | +Inquiry |
Il3-591R | Recombinant Rat Interleukin 3 | +Inquiry |
Il3-107M | Active Recombinant Mouse Il3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *