Recombinant Mouse Il3 protein, His-tagged

• Cat.No.: Il3-4682M
• Product Overview: Recombinant Mouse Il3 protein(P01586)(27-166 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 27-166 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 17.7 kDa
• AASequence: ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Il3 interleukin 3 [ Mus musculus ]
• Official Symbol: Il3
• Synonyms: IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu
• Gene ID: 16187
• mRNA Refseq: NM_010556
• Protein Refseq: NP_034686