Recombinant Mouse Il5 protein

Cat.No. : Il5-206M
Product Overview : Recombinant Mouse Il5 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 113
Description : This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased production of this cytokine may be related to pathogenesis of eosinophil-dependent inflammatory diseases. This cytokine functions by binding to its receptor, which is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene is located on chromosome 5 within a cytokine gene cluster which includes interleukin 4 (IL4), interleukin 13 (IL13), and CSF2 .
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, pH 9.0, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 26.2 kDa, a disulfide-linked homodimeric protein containing two 113 amino acids.
AA Sequence : MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Endotoxin : Less than 0.1 EU/μg of rMuIL-5 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il5
Official Symbol Il5
Synonyms IL5; interleukin 5; interleukin-5; TRF; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Il-5;
Gene ID 16191
mRNA Refseq NM_010558
Protein Refseq NP_034688
UniProt ID P04401

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il5 Products

Required fields are marked with *

My Review for All Il5 Products

Required fields are marked with *

0
cart-icon
0
compare icon