Recombinant Mouse Il5 protein
Cat.No. : | Il5-206M |
Product Overview : | Recombinant Mouse Il5 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 113 |
Description : | This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased production of this cytokine may be related to pathogenesis of eosinophil-dependent inflammatory diseases. This cytokine functions by binding to its receptor, which is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene is located on chromosome 5 within a cytokine gene cluster which includes interleukin 4 (IL4), interleukin 13 (IL13), and CSF2 . |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, pH 9.0, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 26.2 kDa, a disulfide-linked homodimeric protein containing two 113 amino acids. |
AA Sequence : | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
Endotoxin : | Less than 0.1 EU/μg of rMuIL-5 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il5 |
Official Symbol | Il5 |
Synonyms | IL5; interleukin 5; interleukin-5; TRF; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Il-5; |
Gene ID | 16191 |
mRNA Refseq | NM_010558 |
Protein Refseq | NP_034688 |
UniProt ID | P04401 |
◆ Recombinant Proteins | ||
Il5-755M | Recombinant Mouse Il5 protein(Met1-Gly133), His-tagged | +Inquiry |
IL5-2253R | Recombinant Rhesus monkey IL5 Protein, His-tagged | +Inquiry |
Il5-352I | Active Recombinant Rat Il5 Protein (113 aa) | +Inquiry |
Il5-207M | Recombinant Active Mouse IL5 Protein, His-tagged(C-ter) | +Inquiry |
Il5-238I | Active Recombinant Rat Il5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il5 Products
Required fields are marked with *
My Review for All Il5 Products
Required fields are marked with *
0
Inquiry Basket