Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged

• Cat.No.: INS1-2256M
• Product Overview: Recombinant Mouse INS1 Protein (25-108 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 25-108 aa
• Description: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.5 kDa
• AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Ins1 insulin I [ Mus musculus ]
• Official Symbol: INS1
• Synonyms: INS1; insulin I; insulin-1; Ins-1; Ins2-rs1
• Gene ID: 16333
• mRNA Refseq: NM_008386
• Protein Refseq: NP_032412
• UniProt ID: P01325