Recombinant Mouse Proinsulin (25-108aa)
| Cat.No. : | Proinsulln-01M |
| Product Overview : | Recombinant Mouse Proinsulin (25-108aa) was produced without tag. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Tag : | Non |
| Protein Length : | 25-108aa |
| Description : | This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus. |
| Form : | Lyophilized powder |
| Molecular Mass : | (Theoretical molecular weight)~ 9.5 kDa |
| AA Sequence : | FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN |
| Purity : | > 90% as determined by SDS-PAGE |
| Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Storage Buffer : | PBS, pH7.4, with 5% mannitol and 5% trehalose. |
| Gene Name | Ins1 insulin I [ Mus musculus (house mouse) ] |
| Official Symbol | Ins1 |
| Synonyms | Ins1; insulin I; Ins-1; Ins2-rs1; insulin-1; Proinsulln |
| Gene ID | 16333 |
| mRNA Refseq | NM_008386 |
| Protein Refseq | NP_032412 |
| UniProt ID | P01325 |
| ◆ Recombinant Proteins | ||
| Ins1-3730M | Recombinant Mouse Ins1 protein, GST-tagged | +Inquiry |
| INS1-4560M | Recombinant Mouse INS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ins1-12R | Recombinant Rat Ins1 protein, His-tagged | +Inquiry |
| INS1-8233M | Recombinant Mouse INS1 Protein | +Inquiry |
| RFL19133SF | Recombinant Full Length Schizosaccharomyces Pombe Insig Family Protein(Ins1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ins1 Products
Required fields are marked with *
My Review for All Ins1 Products
Required fields are marked with *
