Recombinant Mouse Proinsulin (25-108aa)

Cat.No. : Proinsulln-01M
Product Overview : Recombinant Mouse Proinsulin (25-108aa) was produced without tag.
Availability September 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : Non
Protein Length : 25-108aa
Description : This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus.
Form : Lyophilized powder
Molecular Mass : (Theoretical molecular weight)~ 9.5 kDa
AA Sequence : FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Purity : > 90% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Storage Buffer : PBS, pH7.4, with 5% mannitol and 5% trehalose.
Gene Name Ins1 insulin I [ Mus musculus (house mouse) ]
Official Symbol Ins1
Synonyms Ins1; insulin I; Ins-1; Ins2-rs1; insulin-1; Proinsulln
Gene ID 16333
mRNA Refseq NM_008386
Protein Refseq NP_032412
UniProt ID P01325

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ins1 Products

Required fields are marked with *

My Review for All Ins1 Products

Required fields are marked with *

0
cart-icon