Recombinant Mouse ITGAL Protein (153-325 aa), His-tagged

• Cat.No.: ITGAL-1426M
• Product Overview: Recombinant Mouse ITGAL Protein (153-325 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 153-325 aa
• Description: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.7 kDa
• AA Sequence: DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Itgal integrin alpha L [ Mus musculus ]
• Official Symbol: ITGAL
• Synonyms: ITGAL; Cd11a; LFA-1; Ly-15; Ly-21; (p180); LFA-1A
• Gene ID: 16408
• mRNA Refseq: NM_001253872
• Protein Refseq: NP_001240801
• UniProt ID: P24063