Recombinant Mouse Jak3 protein, His-tagged
Cat.No. : | Jak3-4510M |
Product Overview : | Recombinant Mouse Jak3 protein(Q62137)(818-1100aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 818-1100aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.2 kDa |
AA Sequence : | LKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Jak3 Janus kinase 3 [ Mus musculus ] |
Official Symbol | Jak3 |
Synonyms | JAK3; Janus kinase 3; tyrosine-protein kinase JAK3; fae; wil; |
Gene ID | 16453 |
mRNA Refseq | NM_001190830 |
Protein Refseq | NP_001177759 |
◆ Recombinant Proteins | ||
JAK3-2365HFL | Recombinant Full Length Human JAK3 protein, Flag-tagged | +Inquiry |
JAK3-8410M | Recombinant Mouse JAK3 Protein | +Inquiry |
JAK3-466H | Recombinant Human JAK3 | +Inquiry |
JAK317212H | Recombinant Human JAK3 (810-1100) (C810S) Protein | +Inquiry |
JAK321187H | Recombinant Human JAK3 (810-1115) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAK3-5106HCL | Recombinant Human JAK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Jak3 Products
Required fields are marked with *
My Review for All Jak3 Products
Required fields are marked with *