Recombinant Mouse Jph2 protein, GST-tagged
Cat.No. : | Jph2-6844M |
Product Overview : | Recombinant Mouse Jph2 protein(169-277 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 169-277 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | EHSNGTVAPDSPAADGPMLPSPPVPRGGFALTLLATAEAARPQGLFTRGTLLGRLRRSESRTSLGSQRSRLSFLKSELSSGASDAASTGSLAEGAEGPDDAAAPFDADI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | Jph2 junctophilin 2 [ Mus musculus ] |
Official Symbol | Jph2 |
Synonyms | JPH2; junctophilin 2; junctophilin-2; junctophilin type 2; Jp2; JP-2; 1110002E14Rik; |
Gene ID | 59091 |
mRNA Refseq | NM_001205076 |
Protein Refseq | NP_001192005 |
◆ Recombinant Proteins | ||
Jph2-6844M | Recombinant Mouse Jph2 protein, GST-tagged | +Inquiry |
JPH2-786H | Recombinant Human JPH2 Protein, MYC/DDK-tagged | +Inquiry |
JPH2-3143R | Recombinant Rat JPH2 Protein | +Inquiry |
JPH2-5653H | Recombinant Human JPH2 protein, His-tagged | +Inquiry |
JPH2-1548HFL | Recombinant Full Length Human JPH2 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Jph2 Products
Required fields are marked with *
My Review for All Jph2 Products
Required fields are marked with *