"Kcp" Related Products

Recombinant Mouse KCP Protein, His-tagged

Cat.No.: KCP-12M
Product Overview: Recombinant mouse kcp protein (Val27~Arg242) with N-terminal His tag was expressed in E.coli.
Description: Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways.
Source: E.coli
Species: Mouse
Tag : His
Form: Freeze-dried powder
Molecular Mass: Predicted Molecular Mass: 27.3kDa
Accurate Molecular Mass: 24kDa
AA Sequence: VSERQPRLADAISQQQAPSHSLVPGETHQQQWCPLEERLERLEAEVTDLRKQNRELQARVVQLESCECWGPGHTCPEGARWEPDACTACVCRDGTAHCGPQPNLPHCRGCSHNGQSYGHGETFSPDACTTCRCLAGTVQCQGPSCSELNCLESFIPPGECCPICRPGCEYEGQLHQEGSSFLSSSNPCLQCSCLRSLVRCVPVKCQPSPVLNPVPR
Endotoxin: <1.0EU per 1µg (determined by the LAL method)
Purity: > 90%
Applications: Positive Control; Immunogen; SDS-PAGE; WB.
Usage: Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Storage Buffer: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Gene Name: Kcp
Official Symbol: Kcp kielin/chordin-like protein [ Mus musculus (house mouse) ]
Synonyms: Crim2; Gm793; KCP-1; CRIM-2; AW060220; Kcp; kielin/chordin-like protein; kielin/chordin-like protein; cysteine rich BMP regulator 2 (chordin like); cysteine-rich BMP regulator 2; cysteine-rich motor neuron 2 protein; kielin/chordin-like protein 1
Gene ID: 333088
mRNA Refseq: NM_001029985
Protein Refseq: NP_001025156
UniProt ID: Q3U492
Products Types ◆ Recombinant Protein

Related Gene
KCP

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.