Recombinant Mouse KCP Protein, His-tagged
Cat.No. : | KCP-12M |
Product Overview : | Recombinant mouse kcp protein (Val27~Arg242) with N-terminal His tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-242 a.a. |
Description : | Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways. |
Form : | Freeze-dried powder |
Molecular Mass : | Predicted Molecular Mass: 27.3kDa Accurate Molecular Mass: 24kDa |
AA Sequence : | VSERQPRLADAISQQQAPSHSLVPGETHQQQWCPLEERLERLEAEVTDLRKQNRELQARVVQLESCECWGPGHTCPEGARWEPDACTACVCRDGTAHCGPQPNLPHCRGCSHNGQSYGHGETFSPDACTTCRCLAGTVQCQGPSCSELNCLESFIPPGECCPICRPGCEYEGQLHQEGSSFLSSSNPCLQCSCLRSLVRCVPVKCQPSPVLNPVPR |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 90% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Usage : | Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Storage Buffer : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Gene Name | Kcp |
Official Symbol | Kcp kielin/chordin-like protein [ Mus musculus (house mouse) ] |
Synonyms | Crim2; Gm793; KCP-1; CRIM-2; AW060220; Kcp; kielin/chordin-like protein; kielin/chordin-like protein; cysteine rich BMP regulator 2 (chordin like); cysteine-rich BMP regulator 2; cysteine-rich motor neuron 2 protein; kielin/chordin-like protein 1 |
Gene ID | 333088 |
mRNA Refseq | NM_001029985 |
Protein Refseq | NP_001025156 |
UniProt ID | Q3U492 |
◆ Recombinant Proteins | ||
KCP-4345H | Recombinant Human KCP protein, His&Myc-tagged | +Inquiry |
Kcp-3131M | Recombinant Mouse Kcp protein, His&Myc-tagged | +Inquiry |
Kcp-1710M | Recombinant Mouse Kcp Protein, His-tagged | +Inquiry |
KCP-4763M | Recombinant Mouse KCP Protein, His (Fc)-Avi-tagged | +Inquiry |
KCP-12M | Recombinant Mouse KCP Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcp Products
Required fields are marked with *
My Review for All Kcp Products
Required fields are marked with *
0
Inquiry Basket