Recombinant Mouse Kdelr2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Kdelr2-024M |
| Product Overview : | Recombinant Mouse Kdelr2 protein(Q9CQM2)(1-212aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-212aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.0 kDa |
| AA Sequence : | MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Kdelr2 KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2 [ Mus musculus ] |
| Official Symbol | Kdelr2 |
| Synonyms | KDELR2; KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2; ER lumen protein retaining receptor 2; KDEL receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; 1110007A14Rik; |
| Gene ID | 66913 |
| mRNA Refseq | NM_025841 |
| Protein Refseq | NP_080117 |
| ◆ Recombinant Proteins | ||
| KDELR2-3950C | Recombinant Chicken KDELR2 | +Inquiry |
| RFL10606GF | Recombinant Full Length Chicken Er Lumen Protein Retaining Receptor 2(Kdelr2) Protein, His-Tagged | +Inquiry |
| KDELR2-2891R | Recombinant Rat KDELR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL36751BF | Recombinant Full Length Bovine Er Lumen Protein Retaining Receptor 2(Kdelr2) Protein, His-Tagged | +Inquiry |
| KDELR2-2379R | Recombinant Rhesus monkey KDELR2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KDELR2-5000HCL | Recombinant Human KDELR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kdelr2 Products
Required fields are marked with *
My Review for All Kdelr2 Products
Required fields are marked with *
