| Species : | Mouse | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | His&SUMO | 
                                
                                    | Protein Length : | 1-361 aa | 
                                
                                    | Description : | Motor for anterograde axonal transport of synaptic vesicle precursors. | 
                                
                                    | Form : | Tris-based buffer, 50% glycerol | 
                                
                                    | Molecular Mass : | 56.4 kDa | 
                                
                                    | AA Sequence : | MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIIN | 
                                
                                    | Purity : | > 90% as determined by SDS-PAGE. | 
                                
                                    | Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. | 
                                
                                    | Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
                                
                                    | Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |