Recombinant Mouse KITL Protein, Biotinylated
Cat.No. : | KITL-524M |
Product Overview : | Biotinylated Recombinant Mouse KITL protein was tag free expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Protein Length : | 273 |
Description : | Enables cytokine activity and stem cell factor receptor binding activity. Acts upstream of or within several processes, including positive regulation of cell differentiation; positive regulation of cell population proliferation; and positive regulation of protein phosphorylation. Located in extracellular space and plasma membrane. Is integral component of membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 69 and familial progressive hyperpigmentation with or without hypopigmentation. Orthologous to human KITLG (KIT ligand). |
Form : | Lyophilized |
AA Sequence : | MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Kitl kit ligand [ Mus musculus (house mouse) ] |
Official Symbol | KITL |
Synonyms | Kitl; kit ligand; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted; kit ligand; C-kit ligand; Steel factor; cloud gray; grizzle-belly; hematopoietic growth factor KL; mast cell growth factor; stem cell factor; EC 3.2.1.31 |
Gene ID | 17311 |
mRNA Refseq | NM_013598 |
Protein Refseq | NP_038626 |
UniProt ID | P20826 |
◆ Recombinant Proteins | ||
KITLG-39C | Recombinant Chicken KITLG Protein | +Inquiry |
KITLG-1245H | Recombinant Human KIT Ligand | +Inquiry |
KITLG-055H | Recombinant Human KITLG Protein, His-tagged | +Inquiry |
Kitl-577M | Recombinant Mouse Kitl protein, His-tagged, Biotinylated. | +Inquiry |
RFL17953MF | Recombinant Full Length Mouse Kit Ligand(Kitlg) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kitlg Products
Required fields are marked with *
My Review for All Kitlg Products
Required fields are marked with *
0
Inquiry Basket