Recombinant Mouse KLRD1 Protein, His-tagged

• Cat.No.: KLRD1-8785M
• Product Overview: Recombinant Mouse KLRD1 Protein (32-179 aa) with His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 32-179 aa
• Description: Predicted to enable HLA-E specific inhibitory MHC class Ib receptor activity; MHC protein complex binding activity; and protein antigen binding activity. Predicted to be involved in natural killer cell mediated immunity; regulation of leukocyte mediated cytotoxicity; and stimulatory C-type lectin receptor signaling pathway. Located in external side of plasma membrane. Orthologous to human KLRD1 (killer cell lectin like receptor D1).
• Form: PBS, pH 7.4
• Molecular Mass: 18.1 kDa
• AASequence: INSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPIHHHHHH
• Endotoxin: < 1.0 EU/μg of the protein as determined by the LAL method.
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/mL

Gene Information

• Gene Name: Klrd1 killer cell lectin-like receptor, subfamily D, member 1 [ Mus musculus (house mouse) ]
• Official Symbol: Klrd1
• Synonyms: KLRD1; killer cell lectin-like receptor, subfamily D, member 1; natural killer cells antigen CD94; CD94
• Gene ID: 16643
• mRNA Refseq: NM_010654
• Protein Refseq: NP_034784
• UniProt ID: P52333