Recombinant Mouse KLRD1 Protein, His-tagged
| Cat.No. : | KLRD1-66M |
| Product Overview : | Recombinant Mouse KLRD1 Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Description : | Predicted to enable HLA-E specific inhibitory MHC class Ib receptor activity; MHC protein complex binding activity; and protein antigen binding activity. Predicted to be involved in natural killer cell mediated immunity; regulation of leukocyte mediated cytotoxicity; and stimulatory C-type lectin receptor signaling pathway. Predicted to act upstream of or within adaptive immune response and innate immune response. Located in external side of plasma membrane. Orthologous to human KLRD1 (killer cell lectin like receptor D1). |
| Form : | PBS, pH 7.4. |
| Molecular Mass : | 18.1 kDa |
| AA Sequence : | INSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPIHHHHHH |
| Endotoxin : | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Gene Name | Klrd1 killer cell lectin-like receptor, subfamily D, member 1 [ Mus musculus (house mouse) ] |
| Official Symbol | KLRD1 |
| Synonyms | CD94 |
| Gene ID | 16643 |
| mRNA Refseq | NM_010654 |
| Protein Refseq | NP_034784 |
| UniProt ID | O54707 |
| ◆ Recombinant Proteins | ||
| KLRD1-5643H | Recombinant Human KLRD1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| KLRD1-388H | Recombinant Human KLRD1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KLRD1-4910H | Recombinant Human KLRD1 Protein, GST-tagged | +Inquiry |
| KLRD1-26330TH | Recombinant Human KLRD1 | +Inquiry |
| KLRD1-4888M | Recombinant Mouse KLRD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLRD1-4893HCL | Recombinant Human KLRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRD1 Products
Required fields are marked with *
My Review for All KLRD1 Products
Required fields are marked with *
