Recombinant Mouse KLRD1 Protein, His-tagged

Cat.No. : KLRD1-66M
Product Overview : Recombinant Mouse KLRD1 Protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Description : Predicted to enable HLA-E specific inhibitory MHC class Ib receptor activity; MHC protein complex binding activity; and protein antigen binding activity. Predicted to be involved in natural killer cell mediated immunity; regulation of leukocyte mediated cytotoxicity; and stimulatory C-type lectin receptor signaling pathway. Predicted to act upstream of or within adaptive immune response and innate immune response. Located in external side of plasma membrane. Orthologous to human KLRD1 (killer cell lectin like receptor D1).
Form : PBS, pH 7.4.
Molecular Mass : 18.1 kDa
AA Sequence : INSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPIHHHHHH
Endotoxin : < 1.0 EU/μg of the protein as determined by the LAL method.
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/ml
Gene Name Klrd1 killer cell lectin-like receptor, subfamily D, member 1 [ Mus musculus (house mouse) ]
Official Symbol KLRD1
Synonyms CD94
Gene ID 16643
mRNA Refseq NM_010654
Protein Refseq NP_034784
UniProt ID O54707

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRD1 Products

Required fields are marked with *

My Review for All KLRD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon