Recombinant Mouse LCN3 Protein (19-182 aa), His-SUMO-tagged
Cat.No. : | LCN3-1923M |
Product Overview : | Recombinant Mouse LCN3 Protein (19-182 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-182 aa |
Description : | Transport of lipophilic molecules, possible pheromone-carrier. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.7 kDa |
AA Sequence : | QDSSFLAFNNGNFSGKWFLKALVSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKTHLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAENLVILEQMEKCEPESFYELPSRPSE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Lcn3 lipocalin 3 [ Mus musculus (house mouse) ] |
Official Symbol | LCN3 |
Synonyms | Lcn3; Vnsp1; |
Gene ID | 16820 |
UniProt ID | Q62471 |
◆ Recombinant Proteins | ||
LCN3-1923M | Recombinant Mouse LCN3 Protein (19-182 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN3 Products
Required fields are marked with *
My Review for All LCN3 Products
Required fields are marked with *
0
Inquiry Basket