Recombinant Mouse Lgals2 Protein, His-tagged
| Cat.No. : | Lgals2-7143M |
| Product Overview : | Recombinant Mouse Lgals2 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-130 |
| Description : | This protein binds beta-galactoside. Its physiological function is not yet known. |
| Form : | Liquid |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE |
| Purity : | > 95 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 10 % glycerol,1 mM DTT |
| Gene Name | Lgals2 lectin, galactose-binding, soluble 2 [ Mus musculus (house mouse) ] |
| Official Symbol | Lgals2 |
| Synonyms | Lgals2; lectin, galactose-binding, soluble 2; AI324147; 2200008F12Rik; galectin-2; gal-2 |
| Gene ID | 107753 |
| mRNA Refseq | NM_025622 |
| Protein Refseq | NP_079898 |
| UniProt ID | Q9CQW5 |
| ◆ Recombinant Proteins | ||
| Lgals2-345M | Recombinant Mouse Lgals2 Protein, MYC/DDK-tagged | +Inquiry |
| LGALS2-406P | Active Recombinant Pig LGALS2 protein, His-tagged | +Inquiry |
| Lgals2-7125H | Recombinant Human Lgals2, His-tagged | +Inquiry |
| LGALS2-4435H | Recombinant Human LGALS2 Protein (Met1-Glu132), His tagged | +Inquiry |
| LGALS2-190H | Active Recombinant Human LGALS2 Protein (Thr2-Glu132), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGALS2-4767HCL | Recombinant Human LGALS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgals2 Products
Required fields are marked with *
My Review for All Lgals2 Products
Required fields are marked with *



