Recombinant Mouse Lilrb4 Protein, His-tagged

Cat.No. : Lilrb4-362M
Product Overview : Recombinant Mouse Lilrb4 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 335
Description : Enables integrin binding activity. Involved in negative regulation of mast cell activation involved in immune response. Acts upstream of or within several processes, including alpha-beta T cell proliferation; cellular response to lipopolysaccharide; and response to nematode. Located in external side of plasma membrane. Is expressed in urinary system. Orthologous to human LILRB4 (leukocyte immunoglobulin like receptor B4).
Form : Lyophilized
Molecular Mass : 26 kDa
AA Sequence : MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKILIGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVYAQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Lilrb4 leukocyte immunoglobulin-like receptor, subfamily B, member 4 [ Mus musculus (house mouse) ]
Official Symbol Lilrb4
Synonyms HM18; ILT3; gp49; CD85K; Gp49b; LIR-5
Gene ID 14728
mRNA Refseq NM_013532
Protein Refseq NP_038560
UniProt ID Q64281

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lilrb4 Products

Required fields are marked with *

My Review for All Lilrb4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon