Recombinant Mouse Lingo3 protein, His-tagged

Cat.No. : LINGO3-9123M
Product Overview : Recombinant Mouse Lingo3 fused with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Form : 20mM Tris-HCl, pH 8.0, 100mM NaCl.
Molecular Mass : (Theoretical molecular weight)~56kDa including His tag
AA Sequence : MNHKVHHHHHHMSCPTVCDCTSQTRAVFCAHRRLDTIPGGLPLDTELLDLSGNRLWGLQRGMLSRLGQLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIVGPGIFSGLTALTLLDLRLNQIVLFLDGAFSELGSLQQLEVGDNHLVFVAPGAFAGLAKLSTITLERCNLSTVPGLALAQLPALVALRLRELDIERLPAGALRGLGQLKELEIHHWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALHHLSFLRILDLSQNPISAIPARRLSPLVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGTSPPACAGPQHVQGKSLREFSDILPPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPQGAWLGRVGRVRVLEDGTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITMPGIPGPFFLDSRGVA
Purity : > 90% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.61 mg/ml
Gene Name Lingo3 leucine rich repeat and Ig domain containing 3 [ Mus musculus ]
Official Symbol Lingo3
Synonyms LERN2; AI851712; leucine-rich repeat neuronal protein 6B
Gene ID 237403
mRNA Refseq NM_001013758
Protein Refseq NP_001013780
UniProt ID Q6GQU6
Chromosome Location 10; 10 C1
Function molecular_function

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lingo3 Products

Required fields are marked with *

My Review for All Lingo3 Products

Required fields are marked with *

0
cart-icon