Recombinant Full Length Mouse LIPE Protein, His tagged
Cat.No. : | LIPE-9128M |
Product Overview : | Recombinant Full Length Mouse LIPE Protein (1-759 aa) with His tag was expressed in HEK293. |
Availability | July 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-759 aa |
Description : | Enables several functions, including lipase activity; retinyl-palmitate esterase activity; and serine hydrolase activity. Involved in diacylglycerol catabolic process and ether lipid metabolic process. Acts upstream of or within cellular response to cold; long-chain fatty acid catabolic process; and triglyceride catabolic process. Located in cytosol; lipid droplet; and membrane. Is expressed in adipose tissue; ileum; and male reproductive gland or organ. Human ortholog(s) of this gene implicated in arteriosclerosis; familial partial lipodystrophy type 6; and hypertension. Orthologous to human LIPE (lipase E, hormone sensitive type). |
Molecular Mass : | 84 kDa |
AA Sequence : | HHHHHHHHMDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRASHNLAELEAYLAALTQLRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGCFYGRCLGFQFTPAIRPFLQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKAFWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPVLARLISYDLREGQDSKVLNSLAKSEGPRLELRPRPHQAPRSRALVVHIHGGGFVAQTSKSHEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAYCWAVKHCDLLGSTGERICLAGDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQSSASPSRLLSLMDPLLPLSVLSKCVSAYSGTEAEDHFDSDQKALGVMGLVQRDTSLFLRDLRLGASSWLNSFLELSGRKPQKTTSPTAESVRPTESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMETLGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRSSQGVLHMPLYTSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDSVMFARRLRDLGQPVTLKVVEDLPHGFLSLAALCRETRQATEFCVQRIRLILTPPAAPLN |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from PBS, pH7.4, 5 % Trehalose, 5 % Mannitol |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Gene Name | Lipe lipase, hormone sensitive [ Mus musculus (house mouse) ] |
Official Symbol | LIPE |
Synonyms | LIPE; lipase, hormone sensitive; hormone-sensitive lipase; HSL; 4933403G17Rik; |
Gene ID | 16890 |
mRNA Refseq | NM_001039507 |
Protein Refseq | NP_001034596 |
UniProt ID | P54310 |
◆ Recombinant Proteins | ||
LIPE-26698TH | Recombinant Human LIPE, His-tagged | +Inquiry |
LIPE-3073R | Recombinant Rat LIPE Protein, His (Fc)-Avi-tagged | +Inquiry |
LIPE-073H | Recombinant Human LIPE Protein, His-tagged | +Inquiry |
Lipe-1740M | Recombinant Mouse Lipe Protein, His-tagged | +Inquiry |
LIPE-3417R | Recombinant Rat LIPE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPE-4725HCL | Recombinant Human LIPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIPE Products
Required fields are marked with *
My Review for All LIPE Products
Required fields are marked with *