Recombinant Full Length Mouse LIPE Protein, His tagged

Cat.No. : LIPE-9128M
Product Overview : Recombinant Full Length Mouse LIPE Protein (1-759 aa) with His tag was expressed in HEK293.
Availability August 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 1-759 aa
Description : Enables several functions, including lipase activity; retinyl-palmitate esterase activity; and serine hydrolase activity. Involved in diacylglycerol catabolic process and ether lipid metabolic process. Acts upstream of or within cellular response to cold; long-chain fatty acid catabolic process; and triglyceride catabolic process. Located in cytosol; lipid droplet; and membrane. Is expressed in adipose tissue; ileum; and male reproductive gland or organ. Human ortholog(s) of this gene implicated in arteriosclerosis; familial partial lipodystrophy type 6; and hypertension. Orthologous to human LIPE (lipase E, hormone sensitive type).
Molecular Mass : 84 kDa
AA Sequence : HHHHHHHHMDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRASHNLAELEAYLAALTQLRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGCFYGRCLGFQFTPAIRPFLQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKAFWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPVLARLISYDLREGQDSKVLNSLAKSEGPRLELRPRPHQAPRSRALVVHIHGGGFVAQTSKSHEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAYCWAVKHCDLLGSTGERICLAGDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQSSASPSRLLSLMDPLLPLSVLSKCVSAYSGTEAEDHFDSDQKALGVMGLVQRDTSLFLRDLRLGASSWLNSFLELSGRKPQKTTSPTAESVRPTESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMETLGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRSSQGVLHMPLYTSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDSVMFARRLRDLGQPVTLKVVEDLPHGFLSLAALCRETRQATEFCVQRIRLILTPPAAPLN
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from PBS, pH7.4, 5 % Trehalose, 5 % Mannitol
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
Gene Name Lipe lipase, hormone sensitive [ Mus musculus (house mouse) ]
Official Symbol LIPE
Synonyms LIPE; lipase, hormone sensitive; hormone-sensitive lipase; HSL; 4933403G17Rik;
Gene ID 16890
mRNA Refseq NM_001039507
Protein Refseq NP_001034596
UniProt ID P54310

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIPE Products

Required fields are marked with *

My Review for All LIPE Products

Required fields are marked with *

0
cart-icon