Recombinant Mouse Lta protein, His&Myc-tagged
Cat.No. : | Lta-3187M |
Product Overview : | Recombinant Mouse Lta protein(P09225)(34-202aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 34-202aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.6 kDa |
AA Sequence : | LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Lta lymphotoxin A [ Mus musculus ] |
Official Symbol | Lta |
Synonyms | LTA; lymphotoxin A; lymphotoxin-alpha; TNF beta; lymphotoxin alpha; tumor necrosis factor ligand superfamily member 1; LT; Ltx; Tnfb; LT[a]; LT-[a]; TNFSF1; hlb382; LTalpha; Tnfsf1b; LT-alpha; TNF-beta; MGC117668; |
Gene ID | 16992 |
mRNA Refseq | NM_010735 |
Protein Refseq | NP_034865 |
◆ Recombinant Proteins | ||
LTA-2131HFL | Recombinant Full Length Human LTA Protein, C-Flag-tagged | +Inquiry |
LTA-31535TH | Recombinant Human LTA | +Inquiry |
Lta-3187M | Recombinant Mouse Lta protein, His&Myc-tagged | +Inquiry |
Lta-571R | Recombinant Rat Lta protein, His-tagged | +Inquiry |
LTA-260H | Recombinant Human Lymphotoxin Alpha | +Inquiry |
◆ Native Proteins | ||
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lta Products
Required fields are marked with *
My Review for All Lta Products
Required fields are marked with *