Recombinant Mouse Lxn Protein, His-tagged

• Cat.No.: Lxn-7273M
• Product Overview: Recombinant mouse Lxn, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-222
• Description: Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. May play a role in inflammation.
• Form: Liquid
• Molecular Mass: 27.9 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffer Saline (pH 7.4) containing 30 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Lxn latexin [ Mus musculus (house mouse) ]
• Official Symbol: Lxn
• Synonyms: Lxn; latexin; latexin; ECI; TCI; endogenous carboxypeptidase inhibitor; tissue carboxypeptidase inhibitor
• Gene ID: 17035
• mRNA Refseq: NM_016753
• Protein Refseq: NP_058033
• UniProt ID: P70202