Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged

• Cat.No.: LY6C1-2224M
• Product Overview: Recombinant Mouse LY6C1 Protein (27-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 27-109 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.1 kDa
• AA Sequence: LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Ly6c1 lymphocyte antigen 6 complex, locus C1 [ Mus musculus ]
• Official Symbol: LY6C1
• Synonyms: Ly6c; Ly-6C; Ly-6C1; AA682074; AA959465
• Gene ID: 17067
• mRNA Refseq: NM_010741.3
• Protein Refseq: NP_034871.2
• UniProt ID: P0CW02