Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged

Cat.No. : LY6C1-2224M
Product Overview : Recombinant Mouse LY6C1 Protein (27-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 27-109 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.1 kDa
AA Sequence : LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Ly6c1 lymphocyte antigen 6 complex, locus C1 [ Mus musculus ]
Official Symbol LY6C1
Synonyms Ly6c; Ly-6C; Ly-6C1; AA682074; AA959465;
Gene ID 17067
mRNA Refseq NM_010741.3
Protein Refseq NP_034871.2
UniProt ID P0CW02

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6C1 Products

Required fields are marked with *

My Review for All LY6C1 Products

Required fields are marked with *

0
cart-icon