Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged
Cat.No. : | LY6C1-2224M |
Product Overview : | Recombinant Mouse LY6C1 Protein (27-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-109 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.1 kDa |
AA Sequence : | LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Ly6c1 lymphocyte antigen 6 complex, locus C1 [ Mus musculus ] |
Official Symbol | LY6C1 |
Synonyms | Ly6c; Ly-6C; Ly-6C1; AA682074; AA959465; |
Gene ID | 17067 |
mRNA Refseq | NM_010741.3 |
Protein Refseq | NP_034871.2 |
UniProt ID | P0CW02 |
◆ Recombinant Proteins | ||
LY6C1-2224M | Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged | +Inquiry |
LY6C1-9365M | Recombinant Mouse LY6C1 Protein | +Inquiry |
LY6C1-5248M | Recombinant Mouse LY6C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ly6c1-5588M | Recombinant Mouse Ly6c1 protein, His-sumostar-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6C1 Products
Required fields are marked with *
My Review for All LY6C1 Products
Required fields are marked with *