Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged
| Cat.No. : | LY6C1-2224M |
| Product Overview : | Recombinant Mouse LY6C1 Protein (27-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 27-109 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 11.1 kDa |
| AA Sequence : | LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Ly6c1 lymphocyte antigen 6 complex, locus C1 [ Mus musculus ] |
| Official Symbol | LY6C1 |
| Synonyms | Ly6c; Ly-6C; Ly-6C1; AA682074; AA959465; |
| Gene ID | 17067 |
| mRNA Refseq | NM_010741.3 |
| Protein Refseq | NP_034871.2 |
| UniProt ID | P0CW02 |
| ◆ Recombinant Proteins | ||
| Ly6c1-5588M | Recombinant Mouse Ly6c1 protein, His-sumostar-tagged | +Inquiry |
| LY6C1-5248M | Recombinant Mouse LY6C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LY6C1-2224M | Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged | +Inquiry |
| LY6C1-9365M | Recombinant Mouse LY6C1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6C1 Products
Required fields are marked with *
My Review for All LY6C1 Products
Required fields are marked with *



