Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged

PRODUCTS

Home / Products / Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged

Recombinant Mouse LY6C1 Protein (27-109 aa), His-tagged

LY6C1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LY6C1-2224M
Product Overview : Recombinant Mouse LY6C1 Protein (27-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Source : Yeast
Species : Mouse
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.1 kDa
Protein length : 27-109 aa
AA Sequence : LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : Ly6c1 lymphocyte antigen 6 complex, locus C1 [ Mus musculus ]
Official Symbol : LY6C1
Synonyms : Ly6c; Ly-6C; Ly-6C1; AA682074; AA959465;
Gene ID : 17067
mRNA Refseq : NM_010741.3
Protein Refseq : NP_034871.2
UniProt ID : P0CW02

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.