Recombinant Mouse Ly6e protein, His&Myc-tagged
| Cat.No. : | Ly6e-4511M |
| Product Overview : | Recombinant Mouse Ly6e protein(Q64253)(21-102aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 21-102aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 13.8 kDa |
| AA Sequence : | LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ] |
| Official Symbol | Ly6e |
| Synonyms | LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; ly-6E; stem cell antigen 2; thymic shared antigen 1; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1; |
| Gene ID | 17069 |
| mRNA Refseq | NM_001164036 |
| Protein Refseq | NP_001157508 |
| ◆ Recombinant Proteins | ||
| LY6E-2189M | Recombinant Mouse LY6E Protein (21-102 aa), His-B2M-tagged | +Inquiry |
| LY6E-2596R | Recombinant Rhesus monkey LY6E Protein, His-tagged | +Inquiry |
| Ly6e-1753M | Recombinant Mouse Ly6e Protein, His-tagged | +Inquiry |
| Ly6e-1754R | Recombinant Rat Ly6e Protein, His&GST-tagged | +Inquiry |
| LY6E-2416R | Recombinant Rhesus Macaque LY6E Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ly6e Products
Required fields are marked with *
My Review for All Ly6e Products
Required fields are marked with *
