Recombinant Mouse LY6E Protein (21-102 aa), His-B2M-tagged
Cat.No. : | LY6E-2189M |
Product Overview : | Recombinant Mouse LY6E Protein (21-102 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 21-102 aa |
Description : | Involved in T-cell development. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.8 kDa |
AA Sequence : | LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ] |
Official Symbol | LY6E |
Synonyms | LY6E; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1; |
Gene ID | 17069 |
mRNA Refseq | NM_001164036 |
Protein Refseq | NP_001157508 |
UniProt ID | Q64253 |
◆ Recombinant Proteins | ||
LY6E-6226HF | Recombinant Full Length Human LY6E Protein, GST-tagged | +Inquiry |
LY6E-2416R | Recombinant Rhesus Macaque LY6E Protein, His (Fc)-Avi-tagged | +Inquiry |
Ly6e-1753M | Recombinant Mouse Ly6e Protein, His-tagged | +Inquiry |
LY6E-1743M | Recombinant Mouse LY6E Protein (21-102 aa), His-SUMO-tagged | +Inquiry |
LY6E-5251M | Recombinant Mouse LY6E Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6E Products
Required fields are marked with *
My Review for All LY6E Products
Required fields are marked with *