Recombinant Full Length Human LYPLA1 Protein, GST-tagged
Cat.No. : | LYPLA1-6241HF |
Product Overview : | Human LYPLA1 full-length ORF ( AAH08652, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 230 amino acids |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq |
Molecular Mass : | 51.04 kDa |
AA Sequence : | MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYPLA1 lysophospholipase I [ Homo sapiens ] |
Official Symbol | LYPLA1 |
Synonyms | LYPLA1; lysophospholipase I; acyl-protein thioesterase 1; LPL1; LPL-I; lysoPLA I; lysophospholipase 1; acyl-protein thioesterase-1; lysophospholipid-specific lysophospholipase; APT-1; hAPT1; LYSOPLA; |
Gene ID | 10434 |
mRNA Refseq | NM_006330 |
Protein Refseq | NP_006321 |
MIM | 605599 |
UniProt ID | O75608 |
◆ Recombinant Proteins | ||
LYPLA1-2606R | Recombinant Rhesus monkey LYPLA1 Protein, His-tagged | +Inquiry |
LYPLA1-3517R | Recombinant Rat LYPLA1 Protein | +Inquiry |
LYPLA1-2426R | Recombinant Rhesus Macaque LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lypla1-2813M | Recombinant Mouse Lysophospholipase 1, His-tagged | +Inquiry |
LYPLA1-2387Z | Recombinant Zebrafish LYPLA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLA1-4589HCL | Recombinant Human LYPLA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYPLA1 Products
Required fields are marked with *
My Review for All LYPLA1 Products
Required fields are marked with *
0
Inquiry Basket