Recombinant Mouse Map3k1 protein, His-tagged
| Cat.No. : | Map3k1-3204M |
| Product Overview : | Recombinant Mouse Map3k1 protein(P53349)(1216-1493aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1216-1493aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.8 kDa |
| AA Sequence : | QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Map3k1 mitogen-activated protein kinase kinase kinase 1 [ Mus musculus ] |
| Official Symbol | Map3k1 |
| Synonyms | MAP3K1; mitogen-activated protein kinase kinase kinase 1; MEKK 1; MEK kinase 1; MAPK/ERK kinase kinase 1; mitogen activated protein kinase kinase kinase 1; Mekk; MEKK1; MAPKKK1; |
| Gene ID | 26401 |
| mRNA Refseq | NM_011945 |
| Protein Refseq | NP_036075 |
| ◆ Recombinant Proteins | ||
| MAP3K1-393H | Recombinant Human MAP3K1 Protein, MYC/DDK-tagged | +Inquiry |
| MAP3K1-1515HFL | Recombinant Full Length Human MAP3K1 Protein, C-Flag-tagged | +Inquiry |
| Map3k1-665R | Active Recombinant Rat Mitogen Activated Protein Kinase Kinase Kinase 1 | +Inquiry |
| MAP3K1-4533H | Recombinant Human MAP3K1 Protein (Ile1307-Arg1509), N-His tagged | +Inquiry |
| Map3k1-3204M | Recombinant Mouse Map3k1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Map3k1 Products
Required fields are marked with *
My Review for All Map3k1 Products
Required fields are marked with *
