Recombinant Mouse Map3k1 protein, His-tagged

• Cat.No.: Map3k1-3204M
• Product Overview: Recombinant Mouse Map3k1 protein(P53349)(1216-1493aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1216-1493aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.8 kDa
• AA Sequence: QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Map3k1 mitogen-activated protein kinase kinase kinase 1 [ Mus musculus ]
• Official Symbol: Map3k1
• Synonyms: MAP3K1; mitogen-activated protein kinase kinase kinase 1; MEKK 1; MEK kinase 1; MAPK/ERK kinase kinase 1; mitogen activated protein kinase kinase kinase 1; Mekk; MEKK1; MAPKKK1
• Gene ID: 26401
• mRNA Refseq: NM_011945
• Protein Refseq: NP_036075