Recombinant Mouse Mapk14 protein, His&Myc-tagged
Cat.No. : | Mapk14-7876M |
Product Overview : | Recombinant Mouse Mapk14 protein(P47811)(2-360aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-360aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Gene Name | Mapk14 mitogen-activated protein kinase 14 [ Mus musculus ] |
Official Symbol | Mapk14 |
Synonyms | MAPK14; mitogen-activated protein kinase 14; MAPK 14; p38 MAPK; p38 alpha; MAP kinase 14; MAP kinase p38 alpha; p38 MAP kinase alpha; tRNA synthetase cofactor p38; mitogen activated protein kinase 14; mitogen-activated protein kinase p38 alpha; cytokine suppressive anti-inflammatory drug binding protein 1; p38; Crk1; Mxi2; p38a; CSBP2; Csbp1; PRKM14; PRKM15; p38MAPK; p38alpha; p38-alpha; MGC102436; |
Gene ID | 26416 |
mRNA Refseq | NM_001168508 |
Protein Refseq | NP_001161980 |
◆ Recombinant Proteins | ||
MAPK14-314H | Recombinant Human MAPK14 protein, His/MBP-tagged | +Inquiry |
MAPK14-550H | Active Recombinant Human MAPK14, His-tagged | +Inquiry |
MAPK14-119HFL | Active Recombinant Full Length Human MAPK14(T106M) Mutation Protein, N-GST-tagged | +Inquiry |
MAPK14-177H | Active Recombinant Human MAPK14, His-tagged | +Inquiry |
MAPK14-32H | Recombinant human biotinylated MAPK14, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK14-001HCL | Recombinant Human MAPK14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mapk14 Products
Required fields are marked with *
My Review for All Mapk14 Products
Required fields are marked with *
0
Inquiry Basket