Recombinant Mouse Mc1r Full Length Transmembrane Protein(1-315aa), His-tagged(VLPs)

Cat.No. : Mc1r-0183M
Product Overview : Recombinant Mouse Mc1r Protein(1-315aa)(Q01727), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 1-315aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.6 kDa
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
AA Sequence : MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW
Gene Name Mc1r melanocortin 1 receptor [ Mus musculus ]
Official Symbol Mc1r
Synonyms MC1R; melanocortin 1 receptor; melanocyte-stimulating hormone receptor; MC1-R; MSH-R; tobacco darkening; melanocortin receptor 1; melanocortin-1 receptor; extension recessive yellow; e; Tob; Mshra
Gene ID 17199
mRNA Refseq NM_008559
Protein Refseq NP_032585

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mc1r Products

Required fields are marked with *

My Review for All Mc1r Products

Required fields are marked with *

0
cart-icon
0
compare icon