Recombinant Mouse Mc4r Full Length Transmembrane protein, His-tagged
Cat.No. : | Mc4r-292M |
Product Overview : | Recombinant Mouse Mc4r protein(P56450)(1-332aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-332aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.0 kDa |
AA Sequence : | MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTNMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELSSRY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Mc4r melanocortin 4 receptor [ Mus musculus ] |
Official Symbol | Mc4r |
Synonyms | MC4R; melanocortin 4 receptor; melanocortin receptor 4; MC4-R; Glu3; Fatboy; |
Gene ID | 17202 |
mRNA Refseq | NM_016977 |
Protein Refseq | NP_058673 |
◆ Recombinant Proteins | ||
Mc4r-3987M | Recombinant Mouse Mc4r Protein, Myc/DDK-tagged | +Inquiry |
MC4R-3159C | Recombinant Chicken MC4R | +Inquiry |
RFL8241SF | Recombinant Full Length Pig Melanocortin Receptor 4(Mc4R) Protein, His-Tagged | +Inquiry |
MC4R-5402M | Recombinant Mouse MC4R Protein, His (Fc)-Avi-tagged | +Inquiry |
MC4R-305H | Active Recombinant Human MC4R Full Length Transmembrane protein(Nanodisc) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mc4r Products
Required fields are marked with *
My Review for All Mc4r Products
Required fields are marked with *