Recombinant Mouse MILR1 Protein (34-150 aa), His-Myc-tagged
| Cat.No. : | MILR1-2499M |
| Product Overview : | Recombinant Mouse MILR1 Protein (34-150 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 34-150 aa |
| Description : | Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 20.1 kDa |
| AA Sequence : | ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Milr1 mast cell immunoglobulin like receptor 1 [ Mus musculus (house mouse) ] |
| Official Symbol | MILR1 |
| Synonyms | Milr1; Gm885; Mca32; Allergin-1; |
| Gene ID | 380732 |
| UniProt ID | Q3TB92 |
| ◆ Recombinant Proteins | ||
| MILR1-643H | Recombinant Human MILR1 Protein (Met1-Lys227), HIgG1 Fc-tagged | +Inquiry |
| MILR1-3686R | Recombinant Rat MILR1 Protein | +Inquiry |
| MILR1-001H | Recombinant Human MILR1 Protein, His tagged | +Inquiry |
| MILR1-479M | Recombinant Mouse MILR1 protein(Met1-Ser150), hFc-tagged | +Inquiry |
| MILR1-2499M | Recombinant Mouse MILR1 Protein (34-150 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MILR1 Products
Required fields are marked with *
My Review for All MILR1 Products
Required fields are marked with *
