Recombinant Human MILR1 Protein, His tagged

Cat.No. : MILR1-001H
Product Overview : Recombinant Human MILR1 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 29-131 aa
Description : Predicted to enable transmembrane signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway; mast cell degranulation; and negative regulation of mast cell activation. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane.
Tag : C-His
Molecular Mass : 13 kDa
AA Sequence : MKTNDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol
Concentration : 0.55 mg/mL by Bradford
Gene Name MILR1 mast cell immunoglobulin like receptor 1 [ Homo sapiens (human) ]
Official Symbol MILR1
Synonyms MILR1; mast cell immunoglobulin like receptor 1; MCA32; MCA-32; C17orf60; Allergin-1; allergin-1; llergy inhibitory receptor 1; mast cell antigen 32; probable mast cell antigen 32 homolog
Gene ID 284021
mRNA Refseq NM_001085423
Protein Refseq NP_001078892
UniProt ID Q7Z6M3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MILR1 Products

Required fields are marked with *

My Review for All MILR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon