Recombinant Human MILR1 Protein, His tagged
Cat.No. : | MILR1-001H |
Product Overview : | Recombinant Human MILR1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 29-131 aa |
Description : | Predicted to enable transmembrane signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway; mast cell degranulation; and negative regulation of mast cell activation. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. |
Tag : | C-His |
Molecular Mass : | 13 kDa |
AA Sequence : | MKTNDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Concentration : | 0.55 mg/mL by Bradford |
Gene Name | MILR1 mast cell immunoglobulin like receptor 1 [ Homo sapiens (human) ] |
Official Symbol | MILR1 |
Synonyms | MILR1; mast cell immunoglobulin like receptor 1; MCA32; MCA-32; C17orf60; Allergin-1; allergin-1; llergy inhibitory receptor 1; mast cell antigen 32; probable mast cell antigen 32 homolog |
Gene ID | 284021 |
mRNA Refseq | NM_001085423 |
Protein Refseq | NP_001078892 |
UniProt ID | Q7Z6M3 |
◆ Recombinant Proteins | ||
MILR1-3342R | Recombinant Rat MILR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MILR1-3686R | Recombinant Rat MILR1 Protein | +Inquiry |
MILR1-643H | Recombinant Human MILR1 Protein (Met1-Lys227), HIgG1 Fc-tagged | +Inquiry |
MILR1-2499M | Recombinant Mouse MILR1 Protein (34-150 aa), His-Myc-tagged | +Inquiry |
MILR1-001H | Recombinant Human MILR1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MILR1 Products
Required fields are marked with *
My Review for All MILR1 Products
Required fields are marked with *